Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E4, (ApoE4) Human Recombinant

Apolipoprotein E4, (ApoE4) (1mg) Human Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

34 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Syntenin/SDCBP Antibody Picoband® (Dylight488 Conjugate)
A02475-2-Dylight488 100 µg

Anti-Syntenin/SDCBP Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
SLBP Polyclonal Antibody
RD89227A-01 60 μL

SLBP Polyclonal Antibody

Sign In for Pricing
View Details
SLBP Polyclonal Antibody
RD89227A-02 120 μL

SLBP Polyclonal Antibody

Sign In for Pricing
View Details
SLBP Polyclonal Antibody
RD89227A-03 200 µL

SLBP Polyclonal Antibody

Sign In for Pricing
View Details
YIL102C Antibody
orb853141 2 mg

YIL102C Antibody

Sign In for Pricing
View Details
N3-PEG-OH, 400
HE006002-400 Inquire

N3-PEG-OH, 400

Sign In for Pricing
View Details