Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E4, (ApoE4) 1-199 Human Recombinant

Apolipoprotein E4, (ApoE4) (1mg) 1-199 Human Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

22.9 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQ VTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGR LVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HSD17B11 protein
orb244905-01 20 µg

Human HSD17B11 protein

Sign In for Pricing
View Details
Human HSD17B11 protein
orb244905-02 100 µg

Human HSD17B11 protein

Sign In for Pricing
View Details
Human HSD17B11 protein
orb244905-03 1 mg

Human HSD17B11 protein

Sign In for Pricing
View Details
BIN3, NT (Bridging Integrator 3) (PE)
MBS6465372-01 0.2 mL

BIN3, NT (Bridging Integrator 3) (PE)

Sign In for Pricing
View Details
BIN3, NT (Bridging Integrator 3) (PE)
MBS6465372-02 5x 0.2 mL

BIN3, NT (Bridging Integrator 3) (PE)

Sign In for Pricing
View Details
MMAB Blocking Peptide (Center)
MBS9229193-01 0.5 mg

MMAB Blocking Peptide (Center)

Sign In for Pricing
View Details