Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E4, (ApoE4) 1-162 Human Recombinant

Apolipoprotein E4, (ApoE4) (1mg) 1-162 Human Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

19.2 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQ VTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGR LVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9930111J21Rik1 Mouse Gene Knockout Kit (CRISPR)
KN500534 1 Kit

9930111J21Rik1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-01 20 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-02 100 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-03 500 µg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse DCN Protein (Fc Tag)
PDMM100064-04 1 mg

Recombinant Mouse DCN Protein (Fc Tag)

Sign In for Pricing
View Details
CTSL Antibody
OC-233-01 50 μL

CTSL Antibody

Sign In for Pricing
View Details