Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E4, (ApoE4) 1-132 Human Recombinant

Apolipoprotein E4, (ApoE4) (1mg) 1-132 Human Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

15.5 kDa

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (H1 + TS1), CF488A conjugate, 0.1mg/mL
BNC880687-500 1x 500 µL

Cytokeratin 8 (H1 + TS1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyanine 5.5 bissuccinimidyl ester, potassium salt [same as GE Cy5.5® bisNHS ester]
285-AAT 1 mg

Cyanine 5.5 bissuccinimidyl ester, potassium salt [same as GE Cy5.5® bisNHS ester]

Sign In for Pricing
View Details
GSG1 (NM_001080555) Human Over-expression Lysate
LY421104 100 µg

GSG1 (NM_001080555) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]
E-AB-F1060M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]
E-AB-F1060M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]
E-AB-F1060M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD47 Antibody[CC2C6D4]

Sign In for Pricing
View Details