What is the catalog number for Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant?

The catalog number for Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant is orb2282930.

What sizes are available for Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant?

Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant is available in the following size(s): 1 mg.

Is Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant in stock?

Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant is currently made to order / not held in immediate stock. Contact us for lead time.

Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant

Apolipoprotein E3 (ApoE3) (1mg) 1-162 Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

19146.75 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRAL MDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQ STEELRVRLASHLRKLRKRLLRDA DDLQKRLAVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb1447276 500 µg

Aurora-C Antibody Blocking peptide

Sign In for Pricing

View Details

VAng-Cr3765-100g 100 µg

Recombinant IL1B Protein (Ala117-Ser269) [His]

Sign In for Pricing

View Details

STJ28538 100 µl

Anti-NCS1 antibody

Sign In for Pricing

View Details

TMAS-00421-01 50 μL

Anti-Polyamine modulated factor 1 Antibody (7X516)

Sign In for Pricing

View Details

TMAS-00421-02 100 µL

Anti-Polyamine modulated factor 1 Antibody (7X516)

Sign In for Pricing

View Details

NBP3-14230F 0.1 mL

Mouse Monoclonal ZHX3 Antibody (PCRP-ZHX3-1G3) [FITC]

Sign In for Pricing

View Details