Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E3 (ApoE3) 1-162 Human, Recombinant

Apolipoprotein E3 (ApoE3) (1mg) 1-162 Human, Recombinant

Product Specifications

Source

Protein expressed in Escherichia coli.

Field of Research

Metabolism Research

Purity

95% by Chromatography and SDS-PAGE

Form

Lyophilized 1 mg/vial

Solubility

ApoE is soluble in PBS.

Molecular Weight

19146.75 Da

Storage Conditions

Room temperature, avoid light exposure.

Notes

For research use only.

AA Sequence

MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRAL MDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQ STEELRVRLASHLRKLRKRLLRDA DDLQKRLAVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F2R Rabbit Polyclonal Antibody
E53P10843 100 µL

F2R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)
MBS1422367-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)
MBS1422367-02 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)
MBS1422367-03 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)
MBS1422367-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)
MBS1422367-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. japonica Actin-depolymerizing factor 9 (ADF9)

Sign In for Pricing
View Details