Recombinant Human C-C chemokine receptor type 5 (CCR5) -VLPs (Active)
This Recombinant Human C-C chemokine receptor type 5 (CCR5) -VLPs (Active) spans the amino acid sequence from region 1-352aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CHEMR13; HIV-1 fusion coreceptor; CD antigen CD195
UniProt
P51681
Expression Region
1-352aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
The purity information is not available for VLPs proteins.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 μg/mL can bind Anti-CCR5 recombinant antibody. The EC50 is 1.099-1.287 ng/mL. The VLPs is negative control.
Form
Lyophilized powder
Molecular Weight
42.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized powder
AA Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680050-100 1x 100 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400012-500 1x 500 µL
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940253-500 1x 500 µL
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details