Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

This Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial spans the amino acid sequence from region 24-545aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-12 receptor subunit beta-1; IL-12R subunit beta-1; IL-12R-beta-1; IL-12RB1; IL-12 receptor beta component; CD antigen CD212

UniProt

P42701

Expression Region

24-545aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

86.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Liquid or Lyophilized powder

AA Sequence

CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERRFI1 Antibody
OAGA05888-100UL 100 µL

ERRFI1 Antibody

Sign In for Pricing
View Details
DHX15 Rabbit Polyclonal Antibody
E28PN6458 100 µL

DHX15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Freedom Rocker BlotBot 248
FRB248.G 1 Each

Freedom Rocker BlotBot 248

Sign In for Pricing
View Details
Rat sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
RE2408R-01 48 Tests

Rat sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Rat sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
RE2408R-02 96 Tests

Rat sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details
Snx2 Rat shRNA Lentiviral Particle (Locus ID 291464)
TL704723V 500 µL Each

Snx2 Rat shRNA Lentiviral Particle (Locus ID 291464)

Sign In for Pricing
View Details