Recombinant Human Monocarboxylate transporter 6 (SLC16A5) -VLPs
This Recombinant Human Monocarboxylate transporter 6 (SLC16A5) -VLPs spans the amino acid sequence from region 1-505aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
Product Name Alternative
MCT 6; Monocarboxylate transporter 5; MCT 5; Solute carrier family 16 member 5
UniProt
O15375
Expression Region
1-505aa
Tag
C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cancer Biology
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
56.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized powder
AA Sequence
MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
H2172 96 Tests
Solute Carrier family 30 (member 6 (SLC30A6) Mouse ELISA Kit
Sign In for Pricing
View Details