Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), partial (Active)

This Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), partial (Active) spans the amino acid sequence from region 1-685aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

1-685aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL.

Form

Lyophilized powder

Molecular Weight

76.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized powder

AA Sequence

MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPTAQYFWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYAELPKPYITSNNSNPIEDKDAVTLTCEPETQDTTYLWWVNNQSLSVSSRLELSNDNRTLTVFNIPRNDTTFYECETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPAAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYVELPKPYISSNNSNPIEDKDAVTLTCEPVAENTTYLWWVNNQSLSVSPRLQLSNGNRILTLLSVTRNDTGPYECGIQNSESAKRSDPVTLNVTYGPDTPIISPPDLSYRSGANLNLSCHSDSNPSPQYSWLINGTLRQHTQVLFISKITSNNNGAYACFVSNLATGRNNSIVKNISVSSGDSAPGSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glp1r (NM_012728) Rat Tagged ORF Clone Lentiviral Particle
RR210779L3V 200 µL

Glp1r (NM_012728) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
B4GALT2 antibody
70R-6780 100 µL

B4GALT2 antibody

Sign In for Pricing
View Details
5' ATTO-495 / 3' DABCYL
FP-417-30 30 to 49 nmol

5' ATTO-495 / 3' DABCYL

Sign In for Pricing
View Details
Protease Activated Receptor 4 (PAR4) Rat ELISA Kit
G2184 96 Tests

Protease Activated Receptor 4 (PAR4) Rat ELISA Kit

Sign In for Pricing
View Details
ZNF878 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2819507 1.0 µg DNA

ZNF878 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Reg4 (NM_001004096) Rat Tagged Lenti ORF Clone
RR212155L3 10 µg

Reg4 (NM_001004096) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details