Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), partial (Active)

This Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), partial (Active) spans the amino acid sequence from region 1-685aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Expression Region

1-685aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2μg/mL can bind Anti-CEACAM5 recombinant antibody. The EC50 is 3.572-4.044 ng/mL.

Form

Lyophilized powder

Molecular Weight

76.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized powder

AA Sequence

MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPTAQYFWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYAELPKPYITSNNSNPIEDKDAVTLTCEPETQDTTYLWWVNNQSLSVSSRLELSNDNRTLTVFNIPRNDTTFYECETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPAAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYVELPKPYISSNNSNPIEDKDAVTLTCEPVAENTTYLWWVNNQSLSVSPRLQLSNGNRILTLLSVTRNDTGPYECGIQNSESAKRSDPVTLNVTYGPDTPIISPPDLSYRSGANLNLSCHSDSNPSPQYSWLINGTLRQHTQVLFISKITSNNNGAYACFVSNLATGRNNSIVKNISVSSGDSAPGSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC theta (Phospho-Ser695) Colorimetric Cell-Based ELISA Kit
EKC2203 1 Kit, Containing two 96 Well Plates and all necessary reagents

PKC theta (Phospho-Ser695) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
TTR Mouse Monoclonal Antibody (9D9)
44240 100 µL

TTR Mouse Monoclonal Antibody (9D9)

Sign In for Pricing
View Details
Gpr173 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7126005 3x 1.0 µg

Gpr173 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
ELISA Kit For Caspase-2
E15188c 96 Tests

ELISA Kit For Caspase-2

Sign In for Pricing
View Details
Recombinant Culex quinquefasciatus Odorant-binding protein 56e (6050687)
CSB-BP3143DZM-01 20 µg

Recombinant Culex quinquefasciatus Odorant-binding protein 56e (6050687)

Sign In for Pricing
View Details
Recombinant Culex quinquefasciatus Odorant-binding protein 56e (6050687)
CSB-BP3143DZM-02 100 µg

Recombinant Culex quinquefasciatus Odorant-binding protein 56e (6050687)

Sign In for Pricing
View Details