Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Urokinase-type plasminogen activator (PLAU) (Active)

This Recombinant Human Urokinase-type plasminogen activator (PLAU) (Active) spans the amino acid sequence from region 21-431aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P00749

Expression Region

21-431aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Fully active measured by its ability to cleave a peptide substrate, N-carbobenzyloxy-Gly-Gly-Arg-7-amido-4-methylcoumarin (Z-GGR-AMC) . PLAU needs to be activated by Plasmin to be enzymatically active. The specific activity is above 2000 pmol/min/ug.

Form

Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized powder

AA Sequence

SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Nectin-4 (C-Fc)
PKSM041375-01 10 µg

Recombinant Mouse Nectin-4 (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse Nectin-4 (C-Fc)
PKSM041375-02 50 µg

Recombinant Mouse Nectin-4 (C-Fc)

Sign In for Pricing
View Details
Human C19orf12 activation kit by CRISPRa
GA113216 1 Kit

Human C19orf12 activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC105 Human qPCR Primer Pair (NM_173482)
HP218306 200 Reactions

CCDC105 Human qPCR Primer Pair (NM_173482)

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Human Gene Knockout Kit (CRISPR)
KN416630 1 Kit

DNA PKcs (PRKDC) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-Diaminoacetone Dihydrochloride Hydrate
TRC-D416148-1G 1 g

1,3-Diaminoacetone Dihydrochloride Hydrate

Sign In for Pricing
View Details