Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (ovine)

Tyr-CRF (ovine) is a corticotropin releasing factor/hormone isolated from ovine. CRF is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4833.59

Notes

For research use only.

AA Sequence

YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr215 (NM_146446) Mouse Tagged Lenti ORF Clone
MR212783L4 10 µg

Olfr215 (NM_146446) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human GPR114 knockout cell line
ABC-KH6304 1 Vial

Human GPR114 knockout cell line

Sign In for Pricing
View Details
Human Coiled coil domain containing protein 127 (CCDC127) ELISA kit
GTR10413873 96 Well

Human Coiled coil domain containing protein 127 (CCDC127) ELISA kit

Sign In for Pricing
View Details
Mouse Tyr Pre-designed siRNA Set A
SI115534A 1 Each

Mouse Tyr Pre-designed siRNA Set A

Sign In for Pricing
View Details
ERG Antibody
DF6372-01 100 µL

ERG Antibody

Sign In for Pricing
View Details
ERG Antibody
DF6372-02 200 µL

ERG Antibody

Sign In for Pricing
View Details