Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tyr-CRF (ovine)

Tyr-CRF (ovine) is a corticotropin releasing factor/hormone isolated from ovine. CRF is a hypothalamic hormone, stimulates the release of adrenocorticotropic hormone (ACTH) and of β-endorphin

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

4833.59

Notes

For research use only.

AA Sequence

YSQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRSS8 Rabbit Polyclonal Antibody
TA420980 100 µg

PRSS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IMPG2 Protein Vector (Mouse) (pPM-C-His)
PV191721 500 ng

IMPG2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SUOX (Sulfite Oxidase)
365208 200 µL

SUOX (Sulfite Oxidase)

Sign In for Pricing
View Details
IA-2/PTPRN/IA Rabbit Polyclonal Antibody
orb2719772 100 µg

IA-2/PTPRN/IA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS646384 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ACP3 Antibody
orb2310084-01 20 µg

ACP3 Antibody

Sign In for Pricing
View Details