Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF, bovine

GHRF, bovine is the bovine growth hormone (GH) -releasing factor (GHRF) . GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.

Product Specifications

Purity

≥95%

Molecular Weight

5107.88

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCN
CSB-CL025551HU 10 μg Plasmid + 200 μL Glycerol

UCN

Sign In for Pricing
View Details
Anti-RPS25 Rabbit pAb
GB112141-50 50 μL

Anti-RPS25 Rabbit pAb

Sign In for Pricing
View Details
SLC5A10 Protein Vector (Rat) (pPM-C-HA)
PV306268 500 ng

SLC5A10 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)
MBS1342546-01 0.02 mg (E-Coli)

Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)
MBS1342546-02 0.02 mg (Yeast)

Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details
Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)
MBS1342546-03 0.1 mg (E-Coli)

Recombinant Pseudomonas entomophila Molybdenum cofactor biosynthesis protein A (moaA)

Sign In for Pricing
View Details