Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF, bovine

GHRF, bovine is the bovine growth hormone (GH) -releasing factor (GHRF) . GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.

Product Specifications

Purity

≥95%

Molecular Weight

5107.88

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(4-Boc-piperazinyl)-2-phenylacetic acid
MBS9024222-01 1 g

2-(4-Boc-piperazinyl)-2-phenylacetic acid

Sign In for Pricing
View Details
2-(4-Boc-piperazinyl)-2-phenylacetic acid
MBS9024222-02 5x 1 g

2-(4-Boc-piperazinyl)-2-phenylacetic acid

Sign In for Pricing
View Details
Lentiviral mouse Fbxo48 shRNA (UAS) - Lentiviral mouse Fbxo48 shRNA (UAS, iRFP) (100)
GTR15274407 1 Vial

Lentiviral mouse Fbxo48 shRNA (UAS) - Lentiviral mouse Fbxo48 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Ethyl Cellulose (18-22 cPs) An Ethyl Ether of Cellulose
115500250 250 mg

Ethyl Cellulose (18-22 cPs) An Ethyl Ether of Cellulose

Sign In for Pricing
View Details
Rabbit Anti Human GRASP Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL
IRBAMLTAMALINAAP95200UL 200 µL

Rabbit Anti Human GRASP Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4) (IHC,ELISA) 200UL

Sign In for Pricing
View Details
Histone H3
H5110-13 200 µg

Histone H3

Sign In for Pricing
View Details