Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHRF, bovine

GHRF, bovine is the bovine growth hormone (GH) -releasing factor (GHRF) . GHRF, bovine increases the release of bovine GH, and shows a synergistic effect with Hydrocortisone.

Product Specifications

Purity

≥95%

Molecular Weight

5107.88

Notes

For research use only.

AA Sequence

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-E2F6 Rabbit Monoclonal Antibody
MA2363-.05 50 µL

Anti-E2F6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ALAS2 (5-aminolevulinate Synthase, Erythroid-specific, Mitochondrial, ALAS-E, 5-aminolevulinic acid Synthase 2, Delta-ALA Synthase 2, Delta-aminolevulinate Synthase 2, ALASE, ASB) (APC)
123187-APC 100 µL

ALAS2 (5-aminolevulinate Synthase, Erythroid-specific, Mitochondrial, ALAS-E, 5-aminolevulinic acid Synthase 2, Delta-ALA Synthase 2, Delta-aminolevulinate Synthase 2, ALASE, ASB) (APC)

Sign In for Pricing
View Details
GRM3 Antibody
MBS7123754-01 0.05 mL

GRM3 Antibody

Sign In for Pricing
View Details
GRM3 Antibody
MBS7123754-02 0.1 mL

GRM3 Antibody

Sign In for Pricing
View Details
GRM3 Antibody
MBS7123754-03 5x 0.1 mL

GRM3 Antibody

Sign In for Pricing
View Details
CLIA Kit for Paraoxonase 1 (PON1)
TRV-0052138-01 24 Tests

CLIA Kit for Paraoxonase 1 (PON1)

Sign In for Pricing
View Details