Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTH (1-39), mouse, rat

Adrenocorticotropic Hormone (ACTH) (1-39), mouse, rat is a potent melanocortin 2 (MC2) receptor agonist.

Product Specifications

Purity

≥95%

Molecular Weight

4582.3

Notes

For research use only.

AA Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppy (NM_008918) Mouse Recombinant Protein
PM42464M5 20 µg

Ppy (NM_008918) Mouse Recombinant Protein

Sign In for Pricing
View Details
ALDOB Antibody
orb1336360 100 µg

ALDOB Antibody

Sign In for Pricing
View Details
SLC27A5 Monoclonal Antibody
BT-MCA3410-01 50 µL

SLC27A5 Monoclonal Antibody

Sign In for Pricing
View Details
SLC27A5 Monoclonal Antibody
BT-MCA3410-02 100 µL

SLC27A5 Monoclonal Antibody

Sign In for Pricing
View Details
TGFB3 protein (His tag)
80R-4160 100 ug

TGFB3 protein (His tag)

Sign In for Pricing
View Details
HDAC10 Mouse Monoclonal Antibody [Clone ID: LBI1B1]
AMM09396V 100 µL

HDAC10 Mouse Monoclonal Antibody [Clone ID: LBI1B1]

Sign In for Pricing
View Details