Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTH (1-39), mouse, rat

Adrenocorticotropic Hormone (ACTH) (1-39), mouse, rat is a potent melanocortin 2 (MC2) receptor agonist.

Product Specifications

Purity

≥95%

Molecular Weight

4582.3

Notes

For research use only.

AA Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSBP3 Protein Lysate (Human) with C-Ha Tag
45534033 100 µg

SSBP3 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
KPT 335 10mg
A16078-10 10 mg

KPT 335 10mg

Sign In for Pricing
View Details
Recombinant LSDV RPO30/LSDV035 Protein, N-His
orb2964106-01 50 µg

Recombinant LSDV RPO30/LSDV035 Protein, N-His

Sign In for Pricing
View Details
Recombinant LSDV RPO30/LSDV035 Protein, N-His
orb2964106-02 100 µg

Recombinant LSDV RPO30/LSDV035 Protein, N-His

Sign In for Pricing
View Details
Recombinant LSDV RPO30/LSDV035 Protein, N-His
orb2964106-03 1 mg

Recombinant LSDV RPO30/LSDV035 Protein, N-His

Sign In for Pricing
View Details
STAT5A Antibody
orb675893-01 50 µg

STAT5A Antibody

Sign In for Pricing
View Details