Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[Des-Tyr1]-β-Endorphin, human

[Des-Tyr1]-β-Endorphin, human

Product Specifications

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

≥95%

Molecular Weight

3301.88

Notes

For research use only.

AA Sequence

GGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-FZD3-3×Myc-Neo Plasmid
PVT44483 2 µg

pCMV-FZD3-3×Myc-Neo Plasmid

Sign In for Pricing
View Details
Bag5 (NM_027404) Mouse Tagged Lenti ORF Clone
MR207130L3 10 µg

Bag5 (NM_027404) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal CXCL12/SDF-1 Antibody (MM0211-9N26) [Alexa Fluor 700]
NBP2-12221AF700 0.1 mL

Mouse Monoclonal CXCL12/SDF-1 Antibody (MM0211-9N26) [Alexa Fluor 700]

Sign In for Pricing
View Details
Mouse Acan ELISA Kit
EF013308 96 Tests

Mouse Acan ELISA Kit

Sign In for Pricing
View Details
BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)
123922-FITC 100 µL

BGN (Biglycan, Bone/Cartilage Proteoglycan I, PG-S1, SLRR1A) (FITC)

Sign In for Pricing
View Details
Quercetagetin
E0675-1mg 1 mg

Quercetagetin

Sign In for Pricing
View Details