Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin (138-167) (human)

Leptin (138-167) (human)

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

3254.65

Notes

For research use only.

AA Sequence

SGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Itsn1 activation kit by CRISPRa
GA202226 1 Kit

Mouse Itsn1 activation kit by CRISPRa

Sign In for Pricing
View Details
Uridine Diphosphate Choline Ammonium Salt
TRC-U829930-1MG 1 mg

Uridine Diphosphate Choline Ammonium Salt

Sign In for Pricing
View Details
Histone H3.3C (H3F3C) (NM_001013699) Human Over-expression Lysate
LC423022 20 µg

Histone H3.3C (H3F3C) (NM_001013699) Human Over-expression Lysate

Sign In for Pricing
View Details
SKP2 Mouse Monoclonal Antibody [Clone ID: 6G9D10]
AM06294SU-N 100 µL

SKP2 Mouse Monoclonal Antibody [Clone ID: 6G9D10]

Sign In for Pricing
View Details
SAP30BP (NM_013260) Human Recombinant Protein
TP306462M 100 µg

SAP30BP (NM_013260) Human Recombinant Protein

Sign In for Pricing
View Details
RPL5 (NM_000969) Human Over-expression Lysate
LY400352 100 µg

RPL5 (NM_000969) Human Over-expression Lysate

Sign In for Pricing
View Details