Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leptin (138-167) (human)

Leptin (138-167) (human)

Product Specifications

Field of Research

Metabolism Research

Purity

≥95%

Molecular Weight

3254.65

Notes

For research use only.

AA Sequence

SGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase Conjugated Rabbit Anti-WGA Antibody
HAL-2101-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Anti-WGA Antibody

Sign In for Pricing
View Details
Multi-Well Plates
DP12VS-9-NS-IW 20 Packs/Case

Multi-Well Plates

Sign In for Pricing
View Details
2-Hydroxy-2-(thiophen-2-yl)-2-(thiophen-3-yl)acetic Acid Ethyl Ester (>90%)
TRC-H963550-10MG 10 mg

2-Hydroxy-2-(thiophen-2-yl)-2-(thiophen-3-yl)acetic Acid Ethyl Ester (>90%)

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Protein, His Tag (BA.2/Omicron) (MALS verified)
SPD-C522h-1mg 1 mg

SARS-CoV-2 Spike NTD Protein, His Tag (BA.2/Omicron) (MALS verified)

Sign In for Pricing
View Details
Amplite® Fluorimetric Catalase Assay Kit *Red Fluorescence*
11306-AAT 200 Tests

Amplite® Fluorimetric Catalase Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)
KN421345 1 Kit

GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details