Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-84) (human)

PTH (1-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

9424.62

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)
MBS7021977-01 0.02 mg

Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)

Sign In for Pricing
View Details
Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)
MBS7021977-02 0.1 mg

Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)

Sign In for Pricing
View Details
Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)
MBS7021977-03 5x 0.1 mg

Recombinant Drosophila yakuba G-protein coupled receptor Mth2 (mth2)

Sign In for Pricing
View Details
PIP
329661-01 50 µL

PIP

Sign In for Pricing
View Details
PIP
329661-02 100 µL

PIP

Sign In for Pricing
View Details
Human ALAS2 Pre-designed siRNA Set B
SI000540B 1 Each

Human ALAS2 Pre-designed siRNA Set B

Sign In for Pricing
View Details