Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-84) (human)

PTH (1-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

9424.62

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF432 Rabbit Polyclonal Antibody (FITC)
orb2132794 100 µL

ZNF432 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 2B) ValidElisa Kit
EK340873 96 Well

Human GRIN2B (Glutamate Receptor, Ionotropic, N-Methyl-D-Aspartate 2B) ValidElisa Kit

Sign In for Pricing
View Details
SV40 large T antigen NLS
TP1830-01 1 mg

SV40 large T antigen NLS

Sign In for Pricing
View Details
SV40 large T antigen NLS
TP1830-02 5 mg

SV40 large T antigen NLS

Sign In for Pricing
View Details
SV40 large T antigen NLS
TP1830-03 10 mg

SV40 large T antigen NLS

Sign In for Pricing
View Details
Anti-ZNF140 Polyclonal Antibody
TMAB-14333-01 50 μL

Anti-ZNF140 Polyclonal Antibody

Sign In for Pricing
View Details