Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH (1-84) (human)

PTH (1-84) (human)

Product Specifications

Purity

≥95%

Molecular Weight

9424.62

Notes

For research use only.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Remdesivir (Standard)
HY-104077R-01 5 mg

Remdesivir (Standard)

Sign In for Pricing
View Details
Remdesivir (Standard)
HY-104077R-02 10 mg

Remdesivir (Standard)

Sign In for Pricing
View Details
Remdesivir (Standard)
HY-104077R-03 25 mg

Remdesivir (Standard)

Sign In for Pricing
View Details
Remdesivir (Standard)
HY-104077R-04 50 mg

Remdesivir (Standard)

Sign In for Pricing
View Details
Remdesivir (Standard)
HY-104077R-05 100 mg

Remdesivir (Standard)

Sign In for Pricing
View Details
Rat TPS (Tryptase) ELISA Kit
ER21849 96 Tests

Rat TPS (Tryptase) ELISA Kit

Sign In for Pricing
View Details