Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4282.96

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB08F2-PAG/W 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
Spnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3971505 3x 1.0 µg

Spnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Paulomycin B
orb3024765-01 50 mg

Paulomycin B

Sign In for Pricing
View Details
Paulomycin B
orb3024765-02 10 mg

Paulomycin B

Sign In for Pricing
View Details
Anti-NFAT2/NFATC1 Antibody Picoband® (APC Conjugate)
A00340-1-APC 100 µg/Vial

Anti-NFAT2/NFATC1 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
MLKL Rabbit Polyclonal Antibody
orb581940 100 µL

MLKL Rabbit Polyclonal Antibody

Sign In for Pricing
View Details