Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4282.96

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ifrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6803706 1.0 µg DNA

Ifrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
LIPT1 Rabbit pAb, BF700 conjugated
orb2872248 100 µL

LIPT1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Phospho-Tau (Ser356) Antibody
E18-3143-2 100 µg -100 µL

Phospho-Tau (Ser356) Antibody

Sign In for Pricing
View Details
Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit
MBS9368405-01 48 Well

Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit
MBS9368405-02 96 Well

Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit

Sign In for Pricing
View Details
Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit
MBS9368405-03 5x 96 Well

Bovine Protein Kinase C-Binding Protein NELL1 (NELL1) ELISA Kit

Sign In for Pricing
View Details