Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4282.96

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Amyloid (1-43)
CCP3004-01 1 mg

Beta-Amyloid (1-43)

Sign In for Pricing
View Details
Beta-Amyloid (1-43)
CCP3004-02 5 mg

Beta-Amyloid (1-43)

Sign In for Pricing
View Details
Beta-Amyloid (1-43)
CCP3004-03 10 mg

Beta-Amyloid (1-43)

Sign In for Pricing
View Details
Mouse Monoclonal ULBP-4/RAET1E Antibody (709116) [Janelia Fluor 549]
FAB6285I 0.1 mL

Mouse Monoclonal ULBP-4/RAET1E Antibody (709116) [Janelia Fluor 549]

Sign In for Pricing
View Details
CRT 0066101
445145-01 1 mg

CRT 0066101

Sign In for Pricing
View Details
CRT 0066101
445145-02 2.5 mg

CRT 0066101

Sign In for Pricing
View Details