Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Big Endothelin-1 (1-38), human

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Product Specifications

Field of Research

Epigenetics & Chromatin

Purity

≥95%

Molecular Weight

4282.96

Notes

For research use only.

AA Sequence

CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNE1L siRNA (m)
sc-146357 10 µM

KCNE1L siRNA (m)

Sign In for Pricing
View Details
PTMA, Recombinant, Human, aa1-110, His-Tag (Prothymosin alpha, TMSA)
351461-01 50 µg

PTMA, Recombinant, Human, aa1-110, His-Tag (Prothymosin alpha, TMSA)

Sign In for Pricing
View Details
PTMA, Recombinant, Human, aa1-110, His-Tag (Prothymosin alpha, TMSA)
351461-02 250 µg

PTMA, Recombinant, Human, aa1-110, His-Tag (Prothymosin alpha, TMSA)

Sign In for Pricing
View Details
Mouse Anti-Human NKp30 Monoclonal Antibody, Unconjugated Clone B-S30
MBS335385-01 200 Tests

Mouse Anti-Human NKp30 Monoclonal Antibody, Unconjugated Clone B-S30

Sign In for Pricing
View Details
Mouse Anti-Human NKp30 Monoclonal Antibody, Unconjugated Clone B-S30
MBS335385-02 5x 200 Tests

Mouse Anti-Human NKp30 Monoclonal Antibody, Unconjugated Clone B-S30

Sign In for Pricing
View Details
Pigeon Artemin ELISA Kit
MBS052405 Inquire

Pigeon Artemin ELISA Kit

Sign In for Pricing
View Details