Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (2-36) (human, rat)

Selective Y2 agonist generated from NPY by action of aminopeptidase P.

Product Specifications

Purity

≥95%

Molecular Weight

4108.6

Notes

For research use only.

AA Sequence

PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Suppressor of Fused (SUFU) (NM_016169) Human Over-expression Lysate
LY402511 100 µg

Suppressor of Fused (SUFU) (NM_016169) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
KC-173-01 50 μL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
KC-173-02 100 µL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
Beta-2-Microglobulin Antibody
KC-173-03 1 mL

Beta-2-Microglobulin Antibody

Sign In for Pricing
View Details
PRRX1 (NM_022716) Human Recombinant Protein
TP310393 20 µg

PRRX1 (NM_022716) Human Recombinant Protein

Sign In for Pricing
View Details
QuicKey Pro Bovine Cortisol ELISA Kit
E-OSEL-B0002-01 24 Tests

QuicKey Pro Bovine Cortisol ELISA Kit

Sign In for Pricing
View Details