Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (2-36) (human, rat)

Selective Y2 agonist generated from NPY by action of aminopeptidase P.

Product Specifications

Purity

≥95%

Molecular Weight

4108.6

Notes

For research use only.

AA Sequence

PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP5K1 beta (PIP5K1B) Human Gene Knockout Kit (CRISPR)
KN423713 1 Kit

PIP5K1 beta (PIP5K1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRMT7 Rabbit Monoclonal Antibody [Clone ID: R06-4F6]
TA422120 100 µL

PRMT7 Rabbit Monoclonal Antibody [Clone ID: R06-4F6]

Sign In for Pricing
View Details
PPM1A (NM_021003) Human Over-expression Lysate
LC402820 20 µg

PPM1A (NM_021003) Human Over-expression Lysate

Sign In for Pricing
View Details
Xiaochongliulin
TRC-X171605-50MG 50 mg

Xiaochongliulin

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF594 conjugate, 0.1mg/mL
BNC940461-100 1x 100 µL

Chromogranin A (PHE5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Xylella fastidiosa TaqMan PCR Kit
TM67050 100 Units

Xylella fastidiosa TaqMan PCR Kit

Sign In for Pricing
View Details