Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Neuropeptide Y (2-36) (human, rat)

Selective Y2 agonist generated from NPY by action of aminopeptidase P.

Product Specifications

Purity

≥95%

Molecular Weight

4108.6

Notes

For research use only.

AA Sequence

PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRU Human Gene Knockout Kit (CRISPR)
KN214198RB 1 Kit

PTPRU Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), Biotin conjugate, 0.1mg/mL
BNCB2622-100 1x 100 µL

MSH2 (DNA Mismatch Repair Marker) (MSH2/2622), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Muffle Box Furnace BFMF-1200-100
BFMF-1200-100 1 Unit

Muffle Box Furnace BFMF-1200-100

Sign In for Pricing
View Details
PRKCQ Antibody (Biotin)
KB-3506-01 50 μL

PRKCQ Antibody (Biotin)

Sign In for Pricing
View Details
PRKCQ Antibody (Biotin)
KB-3506-02 100 µL

PRKCQ Antibody (Biotin)

Sign In for Pricing
View Details
PRKCQ Antibody (Biotin)
KB-3506-03 1 mL

PRKCQ Antibody (Biotin)

Sign In for Pricing
View Details