Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endostatin (84-114) -NH2 (JKC367)

Endostatin is a C-terminal fragment of collagen XVIII with a molecular weight of 20 kDa and is a potent inhibitor of primary tumor growth and vascular endothelial cell proliferation and migration. Recent studies have shown that collagen XVIII is a member of a family of collagen-like proteins, known as multiple plexiproteins, which are mainly localized at perivascular locations.

Product Specifications

Purity

≥95%

Solubility

Water: ≥55.2 mg/mL. DMSO: ≥353.2 mg/mL

Molecular Weight

3531.9

Notes

For research use only.

AA Sequence

PGARIFSFDGKDVLRHPTWPQKSVWHGSDPN-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-500 1x 500 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL
BNC742216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL
BNC941266-100 1x 100 µL

Cytokeratin 8 (KRT8) (B22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details