Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin Releasing Peptide (1-31), rat

Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) reduces fasting-induced food intake, increases plasma levels of LH, FSH, and testosterone in rats.

Product Specifications

Purity

≥95%

Molecular Weight

3594.07

Notes

For research use only.

AA Sequence

SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details