Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, human

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY) .

Product Specifications

Purity

≥95%

Molecular Weight

4181.8

Notes

For research use only.

AA Sequence

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRG1 Beta 1 hFc Chimera[Biotin], Human
Z04575-100 100 µg

NRG1 Beta 1 hFc Chimera[Biotin], Human

Sign In for Pricing
View Details
TPH Polyclonal Antibody Bio Conjugated
orb1541050 100 µL

TPH Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Anti-SLC47A1 Polyclonal Antibody
TMAB-12906-01 50 μL

Anti-SLC47A1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC47A1 Polyclonal Antibody
TMAB-12906-02 100 µL

Anti-SLC47A1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SLC47A1 Polyclonal Antibody
TMAB-12906-03 200 µL

Anti-SLC47A1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human TSPYL2 sgRNA gene knockout kit - Lentiviral human TSPYL2 sgRNA gene knockout kit (100)
GTR15395047 1 Vial

Lentiviral human TSPYL2 sgRNA gene knockout kit - Lentiviral human TSPYL2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details