Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, human

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY) .

Product Specifications

Purity

≥95%

Molecular Weight

4181.8

Notes

For research use only.

AA Sequence

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGC32 Rabbit Polyclonal Antibody (AP)
orb971029 100 µL

RGC32 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
SIRT1 Rabbit Polyclonal Antibody (Biotin)
orb2140392 100 µL

SIRT1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CYP2D6
312644-01 50 µg

CYP2D6

Sign In for Pricing
View Details
CYP2D6
312644-02 100 µg

CYP2D6

Sign In for Pricing
View Details
Human MUS81 Protein Lysate
MBS8415641-01 0.02 mg

Human MUS81 Protein Lysate

Sign In for Pricing
View Details
Human MUS81 Protein Lysate
MBS8415641-02 5x 0.02 mg

Human MUS81 Protein Lysate

Sign In for Pricing
View Details