Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pancreatic Polypeptide, human

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY) .

Product Specifications

Purity

≥95%

Molecular Weight

4181.8

Notes

For research use only.

AA Sequence

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eperisone Hydrochloride
TRC-E565800-100MG 100 mg

Eperisone Hydrochloride

Sign In for Pricing
View Details
10-Hydroxyneoline
TN2569 5 mg

10-Hydroxyneoline

Sign In for Pricing
View Details
Tnfrsf18 (NM_009400) Mouse Tagged ORF Clone Lentiviral Particle
MR226190L3V 200 µL

Tnfrsf18 (NM_009400) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LOC498063 Adenovirus (Rat)
27214056 1.0 mL

LOC498063 Adenovirus (Rat)

Sign In for Pricing
View Details
3- (tert-butyl) -4-methyl-2-{2-[ (4-methylphenyl) sulphonyl]hydrazino}-1,3-thiazol-3-ium iodide
OR26871 1 Each

3- (tert-butyl) -4-methyl-2-{2-[ (4-methylphenyl) sulphonyl]hydrazino}-1,3-thiazol-3-ium iodide

Sign In for Pricing
View Details
DRD1
522368-01 100 µL

DRD1

Sign In for Pricing
View Details