Pancreatic Polypeptide, human
Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY) .
Product Specifications
Purity
≥95%
Molecular Weight
4181.8
Notes
For research use only.
AA Sequence
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog