Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34) (reduced)

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4046.63

Notes

For research use only.

AA Sequence

{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spiro[1,3-benzodioxole-2,1'-cyclohexan]-5-amine
sc-280095 250 mg

Spiro[1,3-benzodioxole-2,1'-cyclohexan]-5-amine

Sign In for Pricing
View Details
DGCR6L Polyclonal Antibody
E-AB-18946-01 20 µL

DGCR6L Polyclonal Antibody

Sign In for Pricing
View Details
DGCR6L Polyclonal Antibody
E-AB-18946-02 60 µL

DGCR6L Polyclonal Antibody

Sign In for Pricing
View Details
DGCR6L Polyclonal Antibody
E-AB-18946-03 120 µL

DGCR6L Polyclonal Antibody

Sign In for Pricing
View Details
DGCR6L Polyclonal Antibody
E-AB-18946-04 200 µL

DGCR6L Polyclonal Antibody

Sign In for Pricing
View Details
Hemoglobin subunit alpha Antibody
DF7893-01 100 µL

Hemoglobin subunit alpha Antibody

Sign In for Pricing
View Details