Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34) (reduced)

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4046.63

Notes

For research use only.

AA Sequence

{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat F(ab')2 anti-Mouse IgG (H+L) Secondary Antibody [HRP]
NB120-6823 0.25 mg

Goat Polyclonal Goat F(ab')2 anti-Mouse IgG (H+L) Secondary Antibody [HRP]

Sign In for Pricing
View Details
HIV-type O Envelope
PR-1209 100 µg

HIV-type O Envelope

Sign In for Pricing
View Details
Anti-Celf4/Brunol4 Antibody (BSA and Azide free)
75-438-CF 100 µL

Anti-Celf4/Brunol4 Antibody (BSA and Azide free)

Sign In for Pricing
View Details
Mouse Monoclonal FAM119A Antibody (OTI2G7) [Alexa Fluor 350]
NBP2-72423AF350 0.1 mL

Mouse Monoclonal FAM119A Antibody (OTI2G7) [Alexa Fluor 350]

Sign In for Pricing
View Details
PRM1 Recombinant Protein
OPCD06412-50UG 50 µg

PRM1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Nitrosococcus oceani Glutamate 5-kinase (proB)
MBS1338723-01 0.02 mg (E-Coli)

Recombinant Nitrosococcus oceani Glutamate 5-kinase (proB)

Sign In for Pricing
View Details