Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amyloid Dan Protein (1-34) (reduced)

Amyloid Dan Protein (1-34) (reduced)

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

4046.63

Notes

For research use only.

AA Sequence

{Pyr}-ASNCFAIRHFENKFAVETLICFNLFLNSQEKHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-NFKB1 (S907) Antibody
A11038-50UG 50 µg

Phospho-NFKB1 (S907) Antibody

Sign In for Pricing
View Details
HBP1 Rabbit Polyclonal Antibody (PE)
orb2937973 100 µg

HBP1 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Recombinant human BCDIN3D protein
ATGP1777-050 50 µg

Recombinant human BCDIN3D protein

Sign In for Pricing
View Details
(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide
PC1005409-01 100 mg

(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide

Sign In for Pricing
View Details
(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide
PC1005409-02 250 mg

(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide

Sign In for Pricing
View Details
(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide
PC1005409-03 1 g

(R) -2-Amino-2- (2-fluoro-5-nitrophenyl) -N-methylpropane-1-sulfonamide

Sign In for Pricing
View Details