Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

β Amyloid (1-39) is aAβ Fragment.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

1918.3

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abhd14b Mouse Pre-designed siRNA Set A
HY-RS20206 1 Set

Abhd14b Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bovine PAI-1 protein
orb633329-01 50 µg

Bovine PAI-1 protein

Sign In for Pricing
View Details
Bovine PAI-1 protein
orb633329-02 100 µg

Bovine PAI-1 protein

Sign In for Pricing
View Details
Bovine PAI-1 protein
orb633329-03 200 µg

Bovine PAI-1 protein

Sign In for Pricing
View Details
Bovine PAI-1 protein
orb633329-04 1 mg

Bovine PAI-1 protein

Sign In for Pricing
View Details
1810041L15Rik 3'UTR GFP Stable Cell Line
TU150333 1.0 mL

1810041L15Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details