Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

β-Amyloid (1-39)

β Amyloid (1-39) is aAβ Fragment.

Product Specifications

Field of Research

Neuroscience

Purity

≥95%

Molecular Weight

1918.3

Notes

For research use only.

AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNPR siRNA (Mouse)
CRM8653-01 15 nmol

SYNPR siRNA (Mouse)

Sign In for Pricing
View Details
SYNPR siRNA (Mouse)
CRM8653-02 30 nmol

SYNPR siRNA (Mouse)

Sign In for Pricing
View Details
ALS (IGFALS) Human Over-expression Lysate
orb1357678 100 µg

ALS (IGFALS) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)
MBS1179925-01 0.02 mg (E-Coli)

Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)
MBS1179925-02 0.1 mg (E-Coli)

Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)

Sign In for Pricing
View Details
Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)
MBS1179925-03 0.02 mg (Yeast)

Recombinant Thermoanaerobacter sp. UPF0291 protein Teth514_0818 (Teth514_0818)

Sign In for Pricing
View Details