Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nesfatin-1 (human)

Nesfatin-1 (human)

Product Specifications

Field of Research

Cell Biology

Purity

≥95%

Molecular Weight

9551.87

Notes

For research use only.

AA Sequence

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC81 Antibody - C-terminal region : HRP (ARP68796_P050-HRP)
ARP68796_P050-HRP 100 µL

CCDC81 Antibody - C-terminal region : HRP (ARP68796_P050-HRP)

Sign In for Pricing
View Details
Mouse mmu-miR-7041-3p miRNA Agomir
abx884141-01 5 nmol

Mouse mmu-miR-7041-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7041-3p miRNA Agomir
abx884141-02 10 nmol

Mouse mmu-miR-7041-3p miRNA Agomir

Sign In for Pricing
View Details
Spg7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6429707 1.0 µg DNA

Spg7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
IL2 (Center) Ascites Mouse mAb
E2600381 100 µL

IL2 (Center) Ascites Mouse mAb

Sign In for Pricing
View Details
GATA3 Antibody
25052 100 µL

GATA3 Antibody

Sign In for Pricing
View Details