Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nesfatin-1 (human)

Nesfatin-1 (human)

Product Specifications

Field of Research

Cell Biology

Purity

≥95%

Molecular Weight

9551.87

Notes

For research use only.

AA Sequence

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPR1 Polyclonal Antibody, Biotin Conjugated
A56598-050 50 µL

NPR1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
2-Carboxyphenylboronic acid dihydrate
sc-287873 1 g

2-Carboxyphenylboronic acid dihydrate

Sign In for Pricing
View Details
RN5S304 Protein Vector (Human) (pPM-C-HA)
39879021 500 ng

RN5S304 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
IL7R alpha/CD127 Protein, Rat, Recombinant (mFc Tag)
PR53680M4 50 µg

IL7R alpha/CD127 Protein, Rat, Recombinant (mFc Tag)

Sign In for Pricing
View Details
MVD (NM_002461) Human Over-expression Lysate
LC419305 20 µg

MVD (NM_002461) Human Over-expression Lysate

Sign In for Pricing
View Details
Hist2h2aa1 (BC010564) Mouse Tagged ORF Clone
MG200727 10 µg

Hist2h2aa1 (BC010564) Mouse Tagged ORF Clone

Sign In for Pricing
View Details