Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nesfatin-1 (human)

Nesfatin-1 (human)

Product Specifications

Field of Research

Cell Biology

Purity

≥95%

Molecular Weight

9551.87

Notes

For research use only.

AA Sequence

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)
MBS1475113-06 0.02 mg (Mammalian-Cell)

Recombinant Staphylococcus aureus Uncharacterized response regulatory protein MW0198 (MW0198)

Sign In for Pricing
View Details