Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

This Recombinant Mouse Interleukin-13 (Il13) spans the amino acid sequence from region 19-131aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

UniProt

P20109

Expression Region

19-131aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIS Lite™ Cy3 Bis NTA-Ni Complex
12610-AAT 1 mg

HIS Lite™ Cy3 Bis NTA-Ni Complex

Sign In for Pricing
View Details
Uncoated Human CFD (Complement Factor D) ELISA Kit
E-UNEL-H0274-01 5x 96 Tests

Uncoated Human CFD (Complement Factor D) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human CFD (Complement Factor D) ELISA Kit
E-UNEL-H0274-02 15x 96 Tests

Uncoated Human CFD (Complement Factor D) ELISA Kit

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF647 conjugate, 0.1mg/mL
BNC472720-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (PDCD1/2720), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF568 conjugate, 0.1mg/mL
BNC682060-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PAX5/2060), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-2004
BSFT-2004 1 Unit

Floor Standing Shaking Incubator BSFT-2004

Sign In for Pricing
View Details