Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial (Active)

This Recombinant Human B-cell antigen receptor complex-associated protein beta chain (CD79B), partial spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b

UniProt

P40259

Expression Region

29-159aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 3.214-3.642 ng/mL.

Form

Lyophilized powder

Molecular Weight

16.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 Envelope MAb (Clone 1044526)
MAB10894-SP 25 µg

SARS-CoV-2 Envelope MAb (Clone 1044526)

Sign In for Pricing
View Details
Bradykinin
orb1147117 5 mg

Bradykinin

Sign In for Pricing
View Details
Mouse Monoclonal MMADHC Antibody (OTI1G4) [Alexa Fluor 488]
NBP2-72739AF488 0.1 mL

Mouse Monoclonal MMADHC Antibody (OTI1G4) [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans cct-4 Polyclonal Antibody
MBS7138435 Inquire

Rabbit anti-Caenorhabditis elegans cct-4 Polyclonal Antibody

Sign In for Pricing
View Details
(E) -3- (4-methoxybenzylideneamino) phenylboronic acid, pinacol ester
447890-01 100 mg

(E) -3- (4-methoxybenzylideneamino) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details
(E) -3- (4-methoxybenzylideneamino) phenylboronic acid, pinacol ester
447890-02 250 mg

(E) -3- (4-methoxybenzylideneamino) phenylboronic acid, pinacol ester

Sign In for Pricing
View Details