Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alpha-actinin-1 (Actn1), partial

This Recombinant Mouse Alpha-actinin-1 (Actn1), partial spans the amino acid sequence from region 31-250aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin cytoskeletal isoform; F-actin cross-linking protein; Non-muscle alpha-actinin-1

UniProt

Q7TPR4

Expression Region

31-250aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPHX4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0687903 1.0 µg DNA

EPHX4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PAX3 (Paired Box Protein Pax-3, HuP2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778)
130902 100 µg

PAX3 (Paired Box Protein Pax-3, HuP2, HUP2, MGC120381, MGC120382, MGC120383, MGC120384, MGC134778)

Sign In for Pricing
View Details
Recombinant Langya virus/LayV F/Fusion Protein, C-His
MBS1576450-01 0.1 mg

Recombinant Langya virus/LayV F/Fusion Protein, C-His

Sign In for Pricing
View Details
Recombinant Langya virus/LayV F/Fusion Protein, C-His
MBS1576450-02 1 mg

Recombinant Langya virus/LayV F/Fusion Protein, C-His

Sign In for Pricing
View Details
Recombinant Langya virus/LayV F/Fusion Protein, C-His
MBS1576450-03 5x 1 mg

Recombinant Langya virus/LayV F/Fusion Protein, C-His

Sign In for Pricing
View Details
Rabbit Anti-C21orf70 antibody
SL9979R-01 50 µL

Rabbit Anti-C21orf70 antibody

Sign In for Pricing
View Details