Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage 434 Protein rexA (rexA)

This Recombinant Enterobacteria phage 434 Protein rexA (rexA) spans the amino acid sequence from region 1-279aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P68925

Expression Region

1-279aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Enterobacteria phage 434 (Bacteriophage 434)

Field of Research

Infectious Disease & Virology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKNGFYATYRSKNKGKDKRSINLSVFLNSLLADNHHLQVGSNYLYIHKIDGKTFLFTKTNDKSLVQKINRSKASVEDIKNSLADDESLGFPSFLFVEGDTIGFARTVFGPTTSDLTDFLIGKGMSLSSGERVQIEPLMRGTTKDDVMHMHFIGRTTVKVEAKLPVFGDILKVLGATDIEGELFDSLDIVIKPKFKRDIKKVAKDIIFNPSPQFSDISLRAKDEAGDILTEHYLSEKGHLSAPLNKVTNAEIAEEMAYCYARMKSDILECFKRQVGKVKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM140 Polyclonal Antibody, Biotin Conjugated
A63587-100 100 µL

TMEM140 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ELISA Kit For Pantothenate kinase 4
E12051r 96 Tests

ELISA Kit For Pantothenate kinase 4

Sign In for Pricing
View Details
ROBO4 Protein, Human, Recombinant (His Tag)
MBS8121028-01 0.1 mg

ROBO4 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
ROBO4 Protein, Human, Recombinant (His Tag)
MBS8121028-02 5x 0.1 mg

ROBO4 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Anti-RMDN3 antibody
STJ28383 100 µl

Anti-RMDN3 antibody

Sign In for Pricing
View Details
E430018J23Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3301004 1.0 µg DNA

E430018J23Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details