Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granzyme A (Gzma)

This Recombinant Mouse Granzyme A (Gzma) spans the amino acid sequence from region 29-260aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1; TSP-1

UniProt

P11032

Expression Region

29-260aa

Tag

N-terminal 6xHis-IF2DI-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB40B (SEC4L) discontinued
513379 100 µg

RAB40B (SEC4L) discontinued

Sign In for Pricing
View Details
CYP2B6 Rabbit Polyclonal Antibody
orb578223 100 µL

CYP2B6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Ubxn7 shRNA (UAS) - Lentiviral mouse Ubxn7 shRNA (UAS, iRFP) (25)
GTR15103346 1 Vial

Lentiviral mouse Ubxn7 shRNA (UAS) - Lentiviral mouse Ubxn7 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Sirpa shRNA (UAS) - Lentiviral mouse Sirpa shRNA (UAS, RFP) plasmid
GTR15260893 1 Vial

Lentiviral mouse Sirpa shRNA (UAS) - Lentiviral mouse Sirpa shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
KIF5C Rabbit Polyclonal Antibody (PE)
orb493082 100 µL

KIF5C Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Immortalized Human Coronary Artery Endothelial Cells
ABI-TC003G 1 Vial

Immortalized Human Coronary Artery Endothelial Cells

Sign In for Pricing
View Details